| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) ![]() |
| Family c.3.1.1: C-terminal domain of adrenodoxin reductase-like [51906] (5 proteins) |
| Protein Trimethylamine dehydrogenase, C-terminal domain [51907] (1 species) N-terminal domain is beta/alpha barrel and the middle domain is alpha/beta Rossmann-fold |
| Species Methylophilus methylotrophus, w3a1 [TaxId:17] [51908] (5 PDB entries) |
| Domain d1o95b2: 1o95 B:490-645 [81214] Other proteins in same PDB: d1o95a1, d1o95a3, d1o95b1, d1o95b3, d1o95c_, d1o95d_, d1o95e_, d1o95f_ complexed with adp, amp, fmn, sf4 |
PDB Entry: 1o95 (more details), 3.7 Å
SCOPe Domain Sequences for d1o95b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o95b2 c.3.1.1 (B:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}
rwntdgtnclthdpipgadaslpdqltpeqvmdgkkkigkrvvilnadtyfmapslaekl
ataghevtivsgvhlanymhftleypnmmrrlhelhveelgdhfcsriepgrmeiyniwg
dgskrtyrgpgvsprdantshrwiefdslvlvtgrh
Timeline for d1o95b2: