Lineage for d1o95b1 (1o95 B:1-340)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080377Protein Trimethylamine dehydrogenase, N-terminal domain [51406] (1 species)
    two other domains are alpha/beta Rossmann-like fold and beta/beta/alpha fold
  7. 2080378Species Methylophilus methylotrophus, w3a1 [TaxId:17] [51407] (5 PDB entries)
  8. 2080388Domain d1o95b1: 1o95 B:1-340 [81213]
    Other proteins in same PDB: d1o95a2, d1o95a3, d1o95b2, d1o95b3, d1o95c_, d1o95d_, d1o95e_, d1o95f_
    complexed with adp, amp, fmn, sf4

Details for d1o95b1

PDB Entry: 1o95 (more details), 3.7 Å

PDB Description: Ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein
PDB Compounds: (B:) trimethylamine dehydrogenase

SCOPe Domain Sequences for d1o95b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o95b1 c.1.4.1 (B:1-340) Trimethylamine dehydrogenase, N-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}
ardpkhdilfepiqigpktlrnrfyqvphcigagsdkpgfqsahrsvkaeggwaalntey
csinpesddthrlsariwdegdvrnlkamtdevhkygalagvelwyggahapnmesratp
rgpsqyasefetlsyckemdlsdiaqvqqfyvdaakrsrdagfdivyvygahsylplqfl
npyynkrtdkyggslenrarfwletlekvkhavgsdcaiatrfgvdtvygpgqieaevdg
qkfvemadslvdmwditigdiaewgedagpsrfyqqghtipwvklvkqvskkpvlgvgry
tdpekmieivtkgyadiigcarpsiadpflpqkveqgryd

SCOPe Domain Coordinates for d1o95b1:

Click to download the PDB-style file with coordinates for d1o95b1.
(The format of our PDB-style files is described here.)

Timeline for d1o95b1: