| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) ![]() |
| Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains) |
| Protein Trimethylamine dehydrogenase, N-terminal domain [51406] (1 species) two other domains are alpha/beta Rossmann-like fold and beta/beta/alpha fold |
| Species Methylophilus methylotrophus, w3a1 [TaxId:17] [51407] (5 PDB entries) |
| Domain d1o95b1: 1o95 B:1-340 [81213] Other proteins in same PDB: d1o95a2, d1o95a3, d1o95b2, d1o95b3, d1o95c_, d1o95d_, d1o95e_, d1o95f_ complexed with adp, amp, fmn, sf4 |
| PDB Entry: 1o95 (more details) PDB Description: ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein
PDB Compounds: (B:) trimethylamine dehydrogenaseSCOP Domain Sequences for d1o95b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o95b1 c.1.4.1 (B:1-340) Trimethylamine dehydrogenase, N-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}
ardpkhdilfepiqigpktlrnrfyqvphcigagsdkpgfqsahrsvkaeggwaalntey
csinpesddthrlsariwdegdvrnlkamtdevhkygalagvelwyggahapnmesratp
rgpsqyasefetlsyckemdlsdiaqvqqfyvdaakrsrdagfdivyvygahsylplqfl
npyynkrtdkyggslenrarfwletlekvkhavgsdcaiatrfgvdtvygpgqieaevdg
qkfvemadslvdmwditigdiaewgedagpsrfyqqghtipwvklvkqvskkpvlgvgry
tdpekmieivtkgyadiigcarpsiadpflpqkveqgryd
SCOP Domain Coordinates for d1o95b1:
Click to download the PDB-style file with coordinates for d1o95b1. (The format of our PDB-style files is described here.)
Timeline for d1o95b1:
d1o95b1 appears in SCOP 1.75A | d1o95b1 (click for larger image) d1o95b1 in context of chain Domains from same chain: d1o95b2, d1o95b3 d1o95b1 in context of PDB Domains from other chains: d1o95a1, d1o95a2, d1o95a3, d1o95c_, d1o95d_, d1o95e_, d1o95f_ |
|
|
Copyright © 1994-2013 The SCOP
and Astral authors scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu |