Lineage for d1o95a3 (1o95 A:341-489,A:646-729)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1352304Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 1352305Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) (S)
    this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains
  5. 1352306Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (5 proteins)
  6. 1352347Protein Trimethylamine dehydrogenase, middle domain [51973] (1 species)
  7. 1352348Species Methylophilus methylotrophus, w3a1 [TaxId:17] [51974] (5 PDB entries)
  8. 1352357Domain d1o95a3: 1o95 A:341-489,A:646-729 [81212]
    Other proteins in same PDB: d1o95a1, d1o95a2, d1o95b1, d1o95b2, d1o95c_, d1o95d_, d1o95e_, d1o95f_
    complexed with adp, amp, fmn, sf4

Details for d1o95a3

PDB Entry: 1o95 (more details), 3.7 Å

PDB Description: Ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein
PDB Compounds: (A:) trimethylamine dehydrogenase

SCOPe Domain Sequences for d1o95a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o95a3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}
dirvcigcnvcisrweiggppmictqnatageeyrrgwhpekfrqtknkdsvlivgagps
gseaarvlmesgytvhltdtaekigghlnqvaalpglgewsyhrdyretqitkllkknke
sqlalgqkpmtaddvlqygadkviiatgaXsectlwnelkaresewaendikgiyligda
eaprliadatftghrvareieeanpqiaipykretiawgtphmpggnfkieykv

SCOPe Domain Coordinates for d1o95a3:

Click to download the PDB-style file with coordinates for d1o95a3.
(The format of our PDB-style files is described here.)

Timeline for d1o95a3: