Lineage for d1o95a2 (1o95 A:490-645)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1154265Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 1154266Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) (S)
  5. 1154267Family c.3.1.1: C-terminal domain of adrenodoxin reductase-like [51906] (5 proteins)
  6. 1154308Protein Trimethylamine dehydrogenase, C-terminal domain [51907] (1 species)
    N-terminal domain is beta/alpha barrel and the middle domain is alpha/beta Rossmann-fold
  7. 1154309Species Methylophilus methylotrophus, w3a1 [TaxId:17] [51908] (5 PDB entries)
  8. 1154318Domain d1o95a2: 1o95 A:490-645 [81211]
    Other proteins in same PDB: d1o95a1, d1o95a3, d1o95b1, d1o95b3, d1o95c_, d1o95d_, d1o95e_, d1o95f_
    complexed with adp, amp, fmn, sf4

Details for d1o95a2

PDB Entry: 1o95 (more details), 3.7 Å

PDB Description: Ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein
PDB Compounds: (A:) trimethylamine dehydrogenase

SCOPe Domain Sequences for d1o95a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o95a2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}
rwntdgtnclthdpipgadaslpdqltpeqvmdgkkkigkrvvilnadtyfmapslaekl
ataghevtivsgvhlanymhftleypnmmrrlhelhveelgdhfcsriepgrmeiyniwg
dgskrtyrgpgvsprdantshrwiefdslvlvtgrh

SCOPe Domain Coordinates for d1o95a2:

Click to download the PDB-style file with coordinates for d1o95a2.
(The format of our PDB-style files is described here.)

Timeline for d1o95a2: