Lineage for d1o94c_ (1o94 C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1359291Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1360010Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 1360143Family c.26.2.3: ETFP subunits [52432] (3 proteins)
    alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet
  6. 1360167Protein Small, beta subunit of electron transfer flavoprotein ETFP [81394] (3 species)
    binds AMP
  7. 1360172Species Methylophilus methylotrophus [TaxId:17] [82363] (8 PDB entries)
  8. 1360178Domain d1o94c_: 1o94 C: [81206]
    Other proteins in same PDB: d1o94a1, d1o94a2, d1o94a3, d1o94b1, d1o94b2, d1o94b3, d1o94d_, d1o94f_
    complexed with adp, amp, fmn, sf4

Details for d1o94c_

PDB Entry: 1o94 (more details), 2 Å

PDB Description: Ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein
PDB Compounds: (C:) Electron transfer flavoprotein beta-subunit

SCOPe Domain Sequences for d1o94c_:

Sequence, based on SEQRES records: (download)

>d1o94c_ c.26.2.3 (C:) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]}
mkilvavkqtaaleedfeiredgmdvdedfmmydlnewddfsleeamkikessdtdvevv
vvsvgpdrvdeslrkclakgadravrvwddaaegsdaivvgriltevikkeapdmvfagv
qssdqayastgisvasylnwphaavvadlqykpgdnkavirreleggmlqeveincpavl
tiqlginkpryaslrgikqaatkpieevsladiglsandvgaaqsmsrvrrmyip

Sequence, based on observed residues (ATOM records): (download)

>d1o94c_ c.26.2.3 (C:) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]}
mkilvavkqtaaleedfeirdgmdvdedfmmydlnewddfsleeamkikessddvevvvv
svgpdrvdeslrkclakgadravrvwddaaegsdaivvgriltevikkeapdmvfagvqs
sdqayastgisvasylnwphaavvadlqykpgdnkavirreleggmlqeveincpavlti
qlginkpryaslrgikqaatkpieevsladiglsandvgaaqsmsrvrrmyip

SCOPe Domain Coordinates for d1o94c_:

Click to download the PDB-style file with coordinates for d1o94c_.
(The format of our PDB-style files is described here.)

Timeline for d1o94c_: