SCOPe 2.01: Domain d1o8ue_: 1o8u E:

Lineage for d1o8ue_ (1o8u E:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.3: Crotonase-like [52103] (14 proteins)

6. Protein 6-oxo camphor hydrolase [82331] (1 species)

7. Species Rhodococcus erythropolis [TaxId:1833] [82332] (2 PDB entries)
   Uniprot Q93TU6

8. Domain d1o8ue_: 1o8u E: [81198]
   complexed with na

Details for d1o8ue_

PDB Entry: 1o8u, 2 Å

PDB Description: the 2 angstrom structure of 6-oxo camphor hydrolase: new structural diversity in the crotonase superfamily

PDB Compounds: (E:) 6-oxo camphor hydrolase

SCOPe Domain Sequences for d1o8ue_:

Sequence; same for both SEQRES and ATOM records:

>d1o8ue_ c.14.1.3 (E:) 6-oxo camphor hydrolase {Rhodococcus erythropolis [TaxId: 1833]}
latpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdrenkv
viltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvtnhp
eipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeldart
aldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslglah
ealaaidlg

Timeline for d1o8ue_:

• d1o8ue_ first appeared in SCOP 1.63
  
• d1o8ue_ appears in SCOP 1.75
  
• d1o8ue_ appears in SCOPe 2.02
  
• d1o8ue_ appears in the current release, SCOPe 2.08