Lineage for d1o8ue_ (1o8u E:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 240584Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 240585Superfamily c.14.1: ClpP/crotonase [52096] (3 families) (S)
  5. 240639Family c.14.1.3: Crotonase-like [52103] (6 proteins)
  6. 240648Protein 6-oxo camphor hydrolase [82331] (1 species)
  7. 240649Species Actinomycete (Rhodococcus erythropolis) [82332] (1 PDB entry)
  8. 240654Domain d1o8ue_: 1o8u E: [81198]

Details for d1o8ue_

PDB Entry: 1o8u (more details), 2 Å

PDB Description: the 2 angstrom structure of 6-oxo camphor hydrolase: new structural diversity in the crotonase superfamily

SCOP Domain Sequences for d1o8ue_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o8ue_ c.14.1.3 (E:) 6-oxo camphor hydrolase {Actinomycete (Rhodococcus erythropolis)}
latpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdrenkv
viltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvtnhp
eipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeldart
aldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslglah
ealaaidlg

SCOP Domain Coordinates for d1o8ue_:

Click to download the PDB-style file with coordinates for d1o8ue_.
(The format of our PDB-style files is described here.)

Timeline for d1o8ue_: