![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (3 families) ![]() |
![]() | Family c.14.1.3: Crotonase-like [52103] (6 proteins) |
![]() | Protein 6-oxo camphor hydrolase [82331] (1 species) |
![]() | Species Actinomycete (Rhodococcus erythropolis) [82332] (1 PDB entry) |
![]() | Domain d1o8ue_: 1o8u E: [81198] |
PDB Entry: 1o8u (more details), 2 Å
SCOP Domain Sequences for d1o8ue_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o8ue_ c.14.1.3 (E:) 6-oxo camphor hydrolase {Actinomycete (Rhodococcus erythropolis)} latpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdrenkv viltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvtnhp eipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeldart aldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslglah ealaaidlg
Timeline for d1o8ue_: