Lineage for d1o8ud_ (1o8u D:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 824388Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 824389Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 824543Family c.14.1.3: Crotonase-like [52103] (13 proteins)
  6. 824552Protein 6-oxo camphor hydrolase [82331] (1 species)
  7. 824553Species Rhodococcus erythropolis [TaxId:1833] [82332] (2 PDB entries)
    Uniprot Q93TU6
  8. 824569Domain d1o8ud_: 1o8u D: [81197]

Details for d1o8ud_

PDB Entry: 1o8u (more details), 2 Å

PDB Description: the 2 angstrom structure of 6-oxo camphor hydrolase: new structural diversity in the crotonase superfamily
PDB Compounds: (D:) 6-oxo camphor hydrolase

SCOP Domain Sequences for d1o8ud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o8ud_ c.14.1.3 (D:) 6-oxo camphor hydrolase {Rhodococcus erythropolis [TaxId: 1833]}
tpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdrenkvvi
ltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvtnhpei
pvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeldartal
dygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslglahea
laaidlg

SCOP Domain Coordinates for d1o8ud_:

Click to download the PDB-style file with coordinates for d1o8ud_.
(The format of our PDB-style files is described here.)

Timeline for d1o8ud_: