SCOP 1.63: Domain d1o8ud_: 1o8u D:

Lineage for d1o8ud_ (1o8u D:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (3 families)

5. Family c.14.1.3: Crotonase-like [52103] (6 proteins)

6. Protein 6-oxo camphor hydrolase [82331] (1 species)

7. Species Actinomycete (Rhodococcus erythropolis) [82332] (1 PDB entry)

8. Domain d1o8ud_: 1o8u D: [81197]

Details for d1o8ud_

PDB Entry: 1o8u, 2 Å

PDB Description: the 2 angstrom structure of 6-oxo camphor hydrolase: new structural diversity in the crotonase superfamily

SCOP Domain Sequences for d1o8ud_:

Sequence; same for both SEQRES and ATOM records:

>d1o8ud_ c.14.1.3 (D:) 6-oxo camphor hydrolase {Actinomycete (Rhodococcus erythropolis)}
tpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdrenkvvi
ltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvtnhpei
pvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeldartal
dygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslglahea
laaidlg

Timeline for d1o8ud_:

• d1o8ud_ is new in SCOP 1.63
  
• d1o8ud_ appears in SCOP 1.65
  
• d1o8ud_ appears in the current release, SCOPe 2.08