Lineage for d1o8uc_ (1o8u C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460576Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2460577Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2461344Family c.14.1.3: Crotonase-like [52103] (14 proteins)
  6. 2461353Protein 6-oxo camphor hydrolase [82331] (1 species)
  7. 2461354Species Rhodococcus erythropolis [TaxId:1833] [82332] (2 PDB entries)
    Uniprot Q93TU6
  8. 2461369Domain d1o8uc_: 1o8u C: [81196]
    complexed with na

Details for d1o8uc_

PDB Entry: 1o8u (more details), 2 Å

PDB Description: the 2 angstrom structure of 6-oxo camphor hydrolase: new structural diversity in the crotonase superfamily
PDB Compounds: (C:) 6-oxo camphor hydrolase

SCOPe Domain Sequences for d1o8uc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o8uc_ c.14.1.3 (C:) 6-oxo camphor hydrolase {Rhodococcus erythropolis [TaxId: 1833]}
tpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdrenkvvi
ltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvtnhpei
pvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeldartal
dygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslglahea
laaidlg

SCOPe Domain Coordinates for d1o8uc_:

Click to download the PDB-style file with coordinates for d1o8uc_.
(The format of our PDB-style files is described here.)

Timeline for d1o8uc_: