Lineage for d1o8la_ (1o8l A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813492Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2813493Superfamily b.80.1: Pectin lyase-like [51126] (12 families) (S)
    superhelix turns are made of 3 strands each
  5. 2813494Family b.80.1.1: Pectate lyase-like [51127] (3 proteins)
    this is a repeat family; one repeat unit is 1pxz A:227-250 found in domain
  6. 2813499Protein Pectate lyase [51128] (5 species)
  7. 2813513Species Erwinia chrysanthemi, type C [TaxId:556] [51129] (14 PDB entries)
  8. 2813525Domain d1o8la_: 1o8l A: [81192]
    complexed with ca

Details for d1o8la_

PDB Entry: 1o8l (more details), 2.2 Å

PDB Description: pectate lyase c from erwinia chrysanthemi at ph 4.5 with 5mm ca2+
PDB Compounds: (A:) pectate lyase c

SCOPe Domain Sequences for d1o8la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o8la_ b.80.1.1 (A:) Pectate lyase {Erwinia chrysanthemi, type C [TaxId: 556]}
atdtggyaataggnvtgavsktatsmqdivniidaarldangkkvkggayplvitytgne
dslinaaaanicgqwskdprgveikeftkgitiigangssanfgiwikkssdvvvqnmri
gylpggakdgdmirvddspnvwvdhnelfaanhecdgtpdndttfesavdikgasntvtv
synyihgvkkvgldgssssdtgrnityhhnyyndvnarlplqrgglvhaynnlytnitgs
glnvrqngqaliennwfekainpvtsrydgknfgtwvlkgnnitkpadfstysitwtadt
kpyvnadswtstgtfptvaynyspvsaqcvkdklpgyagvgknlatltstack

SCOPe Domain Coordinates for d1o8la_:

Click to download the PDB-style file with coordinates for d1o8la_.
(The format of our PDB-style files is described here.)

Timeline for d1o8la_: