Lineage for d1o8ia_ (1o8i A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2079406Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2079407Superfamily b.80.1: Pectin lyase-like [51126] (12 families) (S)
    superhelix turns are made of 3 strands each
  5. 2079408Family b.80.1.1: Pectate lyase-like [51127] (3 proteins)
    this is a repeat family; one repeat unit is 1pxz A:227-250 found in domain
  6. 2079413Protein Pectate lyase [51128] (5 species)
  7. 2079427Species Erwinia chrysanthemi, type C [TaxId:556] [51129] (14 PDB entries)
  8. 2079430Domain d1o8ia_: 1o8i A: [81189]

Details for d1o8ia_

PDB Entry: 1o8i (more details), 2.2 Å

PDB Description: pectate lyase c from erwinia chrysanthemi at ph 9.5 with no ca2+ added
PDB Compounds: (A:) pectate lyase c

SCOPe Domain Sequences for d1o8ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o8ia_ b.80.1.1 (A:) Pectate lyase {Erwinia chrysanthemi, type C [TaxId: 556]}
atdtggyaataggnvtgavsktatsmqdivniidaarldangkkvkggayplvitytgne
dslinaaaanicgqwskdprgveikeftkgitiigangssanfgiwikkssdvvvqnmri
gylpggakdgdmirvddspnvwvdhnelfaanhecdgtpdndttfesavdikgasntvtv
synyihgvkkvgldgssssdtgrnityhhnyyndvnarlplqrgglvhaynnlytnitgs
glnvrqngqaliennwfekainpvtsrydgknfgtwvlkgnnitkpadfstysitwtadt
kpyvnadswtstgtfptvaynyspvsaqcvkdklpgyagvgknlatltstack

SCOPe Domain Coordinates for d1o8ia_:

Click to download the PDB-style file with coordinates for d1o8ia_.
(The format of our PDB-style files is described here.)

Timeline for d1o8ia_: