![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.40: D-ribose-5-phosphate isomerase (RpiA), lid domain [75445] (1 family) ![]() |
![]() | Family d.58.40.1: D-ribose-5-phosphate isomerase (RpiA), lid domain [75446] (1 protein) |
![]() | Protein D-ribose-5-phosphate isomerase (RpiA), lid domain [75447] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [75448] (3 PDB entries) |
![]() | Domain d1o8bb2: 1o8b B:127-198 [81183] Other proteins in same PDB: d1o8ba1, d1o8bb1 complexed with abf |
PDB Entry: 1o8b (more details), 1.25 Å
SCOPe Domain Sequences for d1o8bb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o8bb2 d.58.40.1 (B:127-198) D-ribose-5-phosphate isomerase (RpiA), lid domain {Escherichia coli [TaxId: 562]} gkfplpvevipmarsavarqlvklggrpeyrqgvvtdngnvildvhgmeildpiamenai naipgvvtvglf
Timeline for d1o8bb2: