Lineage for d1o8bb2 (1o8b B:127-198)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 257061Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 258276Superfamily d.58.40: D-ribose-5-phosphate isomerase (RpiA), lid domain [75445] (1 family) (S)
  5. 258277Family d.58.40.1: D-ribose-5-phosphate isomerase (RpiA), lid domain [75446] (1 protein)
  6. 258278Protein D-ribose-5-phosphate isomerase (RpiA), lid domain [75447] (3 species)
  7. 258288Species Escherichia coli [TaxId:562] [75448] (3 PDB entries)
  8. 258290Domain d1o8bb2: 1o8b B:127-198 [81183]
    Other proteins in same PDB: d1o8ba1, d1o8bb1
    complexed with abf, mse

Details for d1o8bb2

PDB Entry: 1o8b (more details), 1.25 Å

PDB Description: structure of escherichia coli ribose-5-phosphate isomerase, rpia, complexed with arabinose-5-phosphate.

SCOP Domain Sequences for d1o8bb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o8bb2 d.58.40.1 (B:127-198) D-ribose-5-phosphate isomerase (RpiA), lid domain {Escherichia coli}
gkfplpvevipmarsavarqlvklggrpeyrqgvvtdngnvildvhgmeildpiamenai
naipgvvtvglf

SCOP Domain Coordinates for d1o8bb2:

Click to download the PDB-style file with coordinates for d1o8bb2.
(The format of our PDB-style files is described here.)

Timeline for d1o8bb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o8bb1