Lineage for d1o8bb1 (1o8b B:2-126,B:199-218)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242708Fold c.35: Phosphosugar isomerase [52511] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 242709Superfamily c.35.1: Phosphosugar isomerase [52512] (2 families) (S)
    share a common phosphate-binding site
  5. 242736Family c.35.1.2: D-ribose-5-phosphate isomerase (RpiA), catalytic domain [75176] (1 protein)
  6. 242737Protein D-ribose-5-phosphate isomerase (RpiA), catalytic domain [75177] (3 species)
  7. 242747Species Escherichia coli [TaxId:562] [75178] (3 PDB entries)
  8. 242749Domain d1o8bb1: 1o8b B:2-126,B:199-218 [81182]
    Other proteins in same PDB: d1o8ba2, d1o8bb2
    complexed with abf, mse

Details for d1o8bb1

PDB Entry: 1o8b (more details), 1.25 Å

PDB Description: structure of escherichia coli ribose-5-phosphate isomerase, rpia, complexed with arabinose-5-phosphate.

SCOP Domain Sequences for d1o8bb1:

Sequence, based on SEQRES records: (download)

>d1o8bb1 c.35.1.2 (B:2-126,B:199-218) D-ribose-5-phosphate isomerase (RpiA), catalytic domain {Escherichia coli}
tqdelkkavgwaalqyvqpgtivgvgtgstaahfidalgtmkgqiegavsssdasteklk
slgihvfdlnevdslgiyvdgadeinghmqmikgggaaltrekiiasvaekficiadask
qvdilXanrgadvaligtpdgvktiv

Sequence, based on observed residues (ATOM records): (download)

>d1o8bb1 c.35.1.2 (B:2-126,B:199-218) D-ribose-5-phosphate isomerase (RpiA), catalytic domain {Escherichia coli}
tqdelkkavgwaalqytivgvgtgstaahfidalgtmkgqiegavsssdasteklkslgi
hvfdlnevdslgiyvdgadeinghmqmikgggaltrekiiasvaekficiadaskqvdil
Xanrgadvaligtpdgvktiv

SCOP Domain Coordinates for d1o8bb1:

Click to download the PDB-style file with coordinates for d1o8bb1.
(The format of our PDB-style files is described here.)

Timeline for d1o8bb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o8bb2