Lineage for d1o8ba1 (1o8b A:23-126,A:199-218)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922305Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2922306Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2922494Family c.124.1.4: D-ribose-5-phosphate isomerase (RpiA), catalytic domain [75176] (1 protein)
    share a common phosphate-binding site with the NagB-like family; part of sheet is folded upon itself and forms a barrel-like structure like the CoA transferase subunits
  6. 2922495Protein D-ribose-5-phosphate isomerase (RpiA), catalytic domain [75177] (4 species)
  7. 2922496Species Escherichia coli [TaxId:562] [75178] (3 PDB entries)
  8. 2922497Domain d1o8ba1: 1o8b A:23-126,A:199-218 [81180]
    Other proteins in same PDB: d1o8ba2, d1o8bb2
    complexed with abf
    fragment; missing more than one-third of the common structure and/or sequence

Details for d1o8ba1

PDB Entry: 1o8b (more details), 1.25 Å

PDB Description: structure of escherichia coli ribose-5-phosphate isomerase, rpia, complexed with arabinose-5-phosphate.
PDB Compounds: (A:) Ribose 5-phosphate isomerase

SCOPe Domain Sequences for d1o8ba1:

Sequence, based on SEQRES records: (download)

>d1o8ba1 c.124.1.4 (A:23-126,A:199-218) D-ribose-5-phosphate isomerase (RpiA), catalytic domain {Escherichia coli [TaxId: 562]}
ivgvgtgstaahfidalgtmkgqiegavsssdasteklkslgihvfdlnevdslgiyvdg
adeinghmqmikgggaaltrekiiasvaekficiadaskqvdilXanrgadvaligtpdg
vktiv

Sequence, based on observed residues (ATOM records): (download)

>d1o8ba1 c.124.1.4 (A:23-126,A:199-218) D-ribose-5-phosphate isomerase (RpiA), catalytic domain {Escherichia coli [TaxId: 562]}
ivgvgtgstegavsssdafdlnevdslgiyvdgadeinghmqmikgggaltrekiiasva
ekficiadaskqvdilXanrgadvaligtpdgvktiv

SCOPe Domain Coordinates for d1o8ba1:

Click to download the PDB-style file with coordinates for d1o8ba1.
(The format of our PDB-style files is described here.)

Timeline for d1o8ba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o8ba2