Lineage for d1o7pb_ (1o7p B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1640316Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1640820Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1641078Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
    Pfam PF00866
  6. 1641090Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (4 species)
  7. 1641091Species Pseudomonas putida [TaxId:303] [54440] (10 PDB entries)
  8. 1641098Domain d1o7pb_: 1o7p B: [81167]
    Other proteins in same PDB: d1o7pa1, d1o7pa2
    complexed with edo, fe, fes, ndh, so4

Details for d1o7pb_

PDB Entry: 1o7p (more details), 1.95 Å

PDB Description: naphthalene 1,2-dioxygenase, product complex
PDB Compounds: (B:) Naphthalene 1,2-dioxygenase beta subunit

SCOPe Domain Sequences for d1o7pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o7pb_ d.17.4.4 (B:) Naphthalene 1,2-dioxygenase beta subunit {Pseudomonas putida [TaxId: 303]}
miniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgse
vqyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfit
nvqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdyp
erilqthnlmvfl

SCOPe Domain Coordinates for d1o7pb_:

Click to download the PDB-style file with coordinates for d1o7pb_.
(The format of our PDB-style files is described here.)

Timeline for d1o7pb_: