| Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
| Fold d.17: Cystatin-like [54402] (6 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (8 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
| Family d.17.4.4: Naphthalene 1,2-dioxygenase beta subunit [54438] (1 protein) |
| Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (1 species) |
| Species Pseudomonas putida [TaxId:303] [54440] (8 PDB entries) |
| Domain d1o7nb_: 1o7n B: [81164] Other proteins in same PDB: d1o7na1, d1o7na2 complexed with edo, fe, fes, ind, oxy, so4 |
PDB Entry: 1o7n (more details), 1.4 Å
SCOP Domain Sequences for d1o7nb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o7nb_ d.17.4.4 (B:) Naphthalene 1,2-dioxygenase beta subunit {Pseudomonas putida}
miniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgse
vqyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfit
nvqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdyp
erilqthnlmvfl
Timeline for d1o7nb_: