Lineage for d1o7kb_ (1o7k B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005656Fold d.189: PX domain [64267] (1 superfamily)
    beta(3)-alpha(4); meander beta-sheet packed against array of helices; contains Pro-rich stretch
  4. 3005657Superfamily d.189.1: PX domain [64268] (2 families) (S)
  5. 3005658Family d.189.1.1: PX domain [64269] (6 proteins)
    Pfam PF00787
  6. 3005662Protein p47phox NADPH oxidase [64270] (1 species)
  7. 3005663Species Human (Homo sapiens) [TaxId:9606] [64271] (3 PDB entries)
  8. 3005666Domain d1o7kb_: 1o7k B: [81145]
    Other proteins in same PDB: d1o7ka2
    complexed with so4

Details for d1o7kb_

PDB Entry: 1o7k (more details), 2 Å

PDB Description: human p47 px domain complex with sulphates
PDB Compounds: (B:) neutrophil cytosol factor 1

SCOPe Domain Sequences for d1o7kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o7kb_ d.189.1.1 (B:) p47phox NADPH oxidase {Human (Homo sapiens) [TaxId: 9606]}
tfirhiallgfekrfvpsqhyvymflvkwqdlsekvvyrrfteiyefhktlkemfpieag
ainpenriiphlpapkwfdgqraaenrqgtlteycstlmslptkisrcphlldffkvrpd

SCOPe Domain Coordinates for d1o7kb_:

Click to download the PDB-style file with coordinates for d1o7kb_.
(The format of our PDB-style files is described here.)

Timeline for d1o7kb_: