SCOPe 2.01: Domain d1o7hb_: 1o7h B:

Lineage for d1o7hb_ (1o7h B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
   Pfam PF00866

6. Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (3 species)

7. Species Pseudomonas putida [TaxId:303] [54440] (10 PDB entries)

8. Domain d1o7hb_: 1o7h B: [81139]
   Other proteins in same PDB: d1o7ha1, d1o7ha2
   complexed with edo, fe, fes, so4

Details for d1o7hb_

PDB Entry: 1o7h, 2.2 Å

PDB Description: naphthalene 1,2-dioxygenase with oxidized rieske iron sulphur center site.

PDB Compounds: (B:) Naphthalene 1,2-dioxygenase beta subunit

SCOPe Domain Sequences for d1o7hb_:

Sequence; same for both SEQRES and ATOM records:

>d1o7hb_ d.17.4.4 (B:) Naphthalene 1,2-dioxygenase beta subunit {Pseudomonas putida [TaxId: 303]}
miniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgse
vqyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfit
nvqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdyp
erilqthnlmvfl

Timeline for d1o7hb_:

• d1o7hb_ first appeared in SCOP 1.63
  
• d1o7hb_ appears in SCOP 1.75
  
• d1o7hb_ appears in SCOPe 2.02
  
• d1o7hb_ appears in the current release, SCOPe 2.08