Lineage for d1o7ga2 (1o7g A:155-448)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214642Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2214908Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2215017Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (7 proteins)
    Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1
  6. 2215049Protein Naphthalene 1,2-dioxygenase alpha subunit, C-domain [55970] (5 species)
  7. 2215050Species Pseudomonas putida [TaxId:303] [55971] (10 PDB entries)
  8. 2215053Domain d1o7ga2: 1o7g A:155-448 [81135]
    Other proteins in same PDB: d1o7ga1, d1o7gb_
    complexed with edo, fe, fes, npy, so4

Details for d1o7ga2

PDB Entry: 1o7g (more details), 1.7 Å

PDB Description: naphthalene 1,2-dioxygenase with naphthalene bound in the active site.
PDB Compounds: (A:) Naphthalene 1,2-dioxygenase alpha subunit

SCOPe Domain Sequences for d1o7ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o7ga2 d.129.3.3 (A:155-448) Naphthalene 1,2-dioxygenase alpha subunit, C-domain {Pseudomonas putida [TaxId: 303]}
eapplmdylgdaawylepmfkhsgglelvgppgkvvikanwkapaenfvgdayhvgwtha
sslrsgesifsslagnaalppegaglqmtskygsgmgvlwdgysgvhsadlvpelmafgg
akqerlnkeigdvrariyrshlnctvfpnnsmltcsgvfkvwnpidanttevwtyaivek
dmpedlkrrladsvqrtfgpagfwesddndnmetasqngkkyqsrdsdllsnlgfgedvy
gdavypgvvgksaigetsyrgfyrayqahvsssnwaefehasstwhteltkttd

SCOPe Domain Coordinates for d1o7ga2:

Click to download the PDB-style file with coordinates for d1o7ga2.
(The format of our PDB-style files is described here.)

Timeline for d1o7ga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o7ga1
View in 3D
Domains from other chains:
(mouse over for more information)
d1o7gb_