Lineage for d1o7fa3 (1o7f A:322-445)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2080271Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2082002Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2082008Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
    Pfam PF00027
  6. 2082123Protein Regulatory domain of Epac2, domains 1 and 3 [82197] (1 species)
    duplication: two homologous domains of this fold are separated in the sequence by a DEP domain
  7. 2082124Species Mouse (Mus musculus) [TaxId:10090] [82198] (1 PDB entry)
  8. 2082126Domain d1o7fa3: 1o7f A:322-445 [81133]
    Other proteins in same PDB: d1o7fa1

Details for d1o7fa3

PDB Entry: 1o7f (more details), 2.5 Å

PDB Description: crystal structure of the regulatory domain of epac2
PDB Compounds: (A:) camp-dependent rap1 guanine-nucleotide exchange factor

SCOPe Domain Sequences for d1o7fa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]}
tvddleiiydellhikalshlsttvkrelagvlifeshakggtvlfnqgeegtswyiilk
gsvnvviygkgvvctlhegddfgklalvndapraasivlrednchflrvdkedfnrilrd
vean

SCOPe Domain Coordinates for d1o7fa3:

Click to download the PDB-style file with coordinates for d1o7fa3.
(The format of our PDB-style files is described here.)

Timeline for d1o7fa3: