Class b: All beta proteins [48724] (177 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) |
Family b.82.3.2: cAMP-binding domain [51210] (13 proteins) Pfam PF00027 |
Protein Regulatory domain of Epac2, domains 1 and 3 [82197] (1 species) duplication: two homologous domains of this fold are separated in the sequence by a DEP domain |
Species Mouse (Mus musculus) [TaxId:10090] [82198] (1 PDB entry) |
Domain d1o7fa3: 1o7f A:322-445 [81133] Other proteins in same PDB: d1o7fa1 |
PDB Entry: 1o7f (more details), 2.5 Å
SCOPe Domain Sequences for d1o7fa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} tvddleiiydellhikalshlsttvkrelagvlifeshakggtvlfnqgeegtswyiilk gsvnvviygkgvvctlhegddfgklalvndapraasivlrednchflrvdkedfnrilrd vean
Timeline for d1o7fa3: