Lineage for d1o7fa1 (1o7f A:180-321)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2306510Family a.4.5.31: DEP domain [63483] (5 proteins)
    membrane-binding domain
  6. 2306520Protein Regulatory domain of epac2, domain 2 [81693] (1 species)
  7. 2306521Species Mouse (Mus musculus) [TaxId:10090] [81694] (1 PDB entry)
  8. 2306522Domain d1o7fa1: 1o7f A:180-321 [81131]
    Other proteins in same PDB: d1o7fa2, d1o7fa3

Details for d1o7fa1

PDB Entry: 1o7f (more details), 2.5 Å

PDB Description: crystal structure of the regulatory domain of epac2
PDB Compounds: (A:) camp-dependent rap1 guanine-nucleotide exchange factor

SCOPe Domain Sequences for d1o7fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o7fa1 a.4.5.31 (A:180-321) Regulatory domain of epac2, domain 2 {Mouse (Mus musculus) [TaxId: 10090]}
vpsekilragkilriailsraphmirdrkyhlktyrqccvgtelvdwmiqqtscvhsrtq
avgmwqvlledgvlnhvdqerhfqdkylfyrfldderedaplpteeekkecdeelqdtml
llsqmgpdahmrmilrkppgqr

SCOPe Domain Coordinates for d1o7fa1:

Click to download the PDB-style file with coordinates for d1o7fa1.
(The format of our PDB-style files is described here.)

Timeline for d1o7fa1: