| Class b: All beta proteins [48724] (144 folds) |
| Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.1: Single hybrid motif [51230] (1 family) ![]() 7 to 8 strands in 2 beta-sheets |
| Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (6 proteins) |
| Protein Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) [51234] (1 species) |
| Species Propionibacterium freudenreichii, subsp. shermanii [TaxId:1744] [51235] (3 PDB entries) |
| Domain d1o78a_: 1o78 A: [81130] |
PDB Entry: 1o78 (more details)
SCOP Domain Sequences for d1o78a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o78a_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii}
mklkvtvngagkagegeipaplagtvskilvkegdtvkagqtvlvleamkmeteinaptd
gkvekvlvkerdavqggqglikig
Timeline for d1o78a_: