SCOP 1.63: Domain d1o77b_: 1o77 B:

Lineage for d1o77b_ (1o77 B:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.2: Toll/Interleukin receptor TIR domain [52200] (1 family)

5. Family c.23.2.1: Toll/Interleukin receptor TIR domain [52201] (2 proteins)

6. Protein Toll-like receptor 2, TLR2 [52204] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52205] (3 PDB entries)

8. Domain d1o77b_: 1o77 B: [81126]

Details for d1o77b_

PDB Entry: 1o77, 3.2 Å

PDB Description: crystal structure of the c713s mutant of the tir domain of human tlr2

SCOP Domain Sequences for d1o77b_:

Sequence, based on SEQRES records:

>d1o77b_ c.23.2.1 (B:) Toll-like receptor 2, TLR2 {Human (Homo sapiens)}
icydafvsyserdaywvenlmvqelenfnppfklclhkrdfipgkwiidniidsiekshk
tvfvlsenfvksewskyeldfshfrlfdenndaailillepiekkaipqrfcklrkimnt
ktylewpmdeaqregfwvnlraaiks

Sequence, based on observed residues (ATOM records):

>d1o77b_ c.23.2.1 (B:) Toll-like receptor 2, TLR2 {Human (Homo sapiens)}
icydafvsyserdaywvenlmvqelenfnppfklclhkrdfipgkwiidniidsiekshk
tvfvlsenfvksewskyellfaailillepiekkaipqrfcklrkimntktylewpmdea
qregfwvnlraaiks

Timeline for d1o77b_:

• d1o77b_ is new in SCOP 1.63
  
• d1o77b_ appears in SCOP 1.65
  
• d1o77b_ appears in the current release, SCOPe 2.08