SCOPe 2.06: Domain d1o77a_: 1o77 A:

Lineage for d1o77a_ (1o77 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.2: Toll/Interleukin receptor TIR domain [52200] (2 families)

5. Family c.23.2.1: Toll/Interleukin receptor TIR domain [52201] (3 proteins)
   automatically mapped to Pfam PF01582

6. Protein Toll-like receptor 2, TLR2 [52204] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52205] (3 PDB entries)

8. Domain d1o77a_: 1o77 A: [81125]
   mutant

Details for d1o77a_

PDB Entry: 1o77, 3.2 Å

PDB Description: crystal structure of the c713s mutant of the tir domain of human tlr2

PDB Compounds: (A:) toll-like receptor 2

SCOPe Domain Sequences for d1o77a_:

Sequence, based on SEQRES records:

>d1o77a_ c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (Homo sapiens) [TaxId: 9606]}
icydafvsyserdaywvenlmvqelenfnppfklclhkrdfipgkwiidniidsiekshk
tvfvlsenfvksewskyeldfshfrlfdenndaailillepiekkaipqrfcklrkimnt
ktylewpmdeaqregfwvnlraaiks

Sequence, based on observed residues (ATOM records):

>d1o77a_ c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (Homo sapiens) [TaxId: 9606]}
icydafvsyserdaywvenlmvqelenfnppfklclhkrdfipgkwiidniidsiekshk
tvfvlsenfvksewskyeldfshfrlfaailillepiekkaipqrfcklrkimntktyle
wpmdeaqregfwvnlraaiks

Timeline for d1o77a_:

• d1o77a_ first appeared in SCOP 1.63
  
• d1o77a_ appears in SCOPe 2.05
  
• d1o77a_ appears in SCOPe 2.07
  
• d1o77a_ appears in the current release, SCOPe 2.08