Lineage for d1o77a_ (1o77 A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 241017Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 241173Superfamily c.23.2: Toll/Interleukin receptor TIR domain [52200] (1 family) (S)
  5. 241174Family c.23.2.1: Toll/Interleukin receptor TIR domain [52201] (2 proteins)
  6. 241178Protein Toll-like receptor 2, TLR2 [52204] (1 species)
  7. 241179Species Human (Homo sapiens) [TaxId:9606] [52205] (3 PDB entries)
  8. 241182Domain d1o77a_: 1o77 A: [81125]

Details for d1o77a_

PDB Entry: 1o77 (more details), 3.2 Å

PDB Description: crystal structure of the c713s mutant of the tir domain of human tlr2

SCOP Domain Sequences for d1o77a_:

Sequence, based on SEQRES records: (download)

>d1o77a_ c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (Homo sapiens)}
icydafvsyserdaywvenlmvqelenfnppfklclhkrdfipgkwiidniidsiekshk
tvfvlsenfvksewskyeldfshfrlfdenndaailillepiekkaipqrfcklrkimnt
ktylewpmdeaqregfwvnlraaiks

Sequence, based on observed residues (ATOM records): (download)

>d1o77a_ c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (Homo sapiens)}
icydafvsyserdaywvenlmvqelenfnppfklclhkrdfipgkwiidniidsiekshk
tvfvlsenfvksewskyeldfshfrlfaailillepiekkaipqrfcklrkimntktyle
wpmdeaqregfwvnlraaiks

SCOP Domain Coordinates for d1o77a_:

Click to download the PDB-style file with coordinates for d1o77a_.
(The format of our PDB-style files is described here.)

Timeline for d1o77a_: