Lineage for d1o75b2 (1o75 B:333-413)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2039840Superfamily b.1.20: Tp47 lipoprotein, middle and C-terminal domains [81986] (1 family) (S)
  5. 2039841Family b.1.20.1: Tp47 lipoprotein, middle and C-terminal domains [81987] (1 protein)
    contains two different domains of immunoglobulin-like fold
  6. 2039842Protein Tp47 lipoprotein, middle and C-terminal domains [81988] (1 species)
    a penicillin-binding protein with carboxypeptidase activity
  7. 2039843Species Treponema pallidum [TaxId:160] [81989] (1 PDB entry)
  8. 2039847Domain d1o75b2: 1o75 B:333-413 [81121]
    Other proteins in same PDB: d1o75a3, d1o75b3
    complexed with pdx, xe

Details for d1o75b2

PDB Entry: 1o75 (more details), 1.95 Å

PDB Description: tp47, the 47-kilodalton lipoprotein of treponema pallidum
PDB Compounds: (B:) 47 kda membrane antigen

SCOPe Domain Sequences for d1o75b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o75b2 b.1.20.1 (B:333-413) Tp47 lipoprotein, middle and C-terminal domains {Treponema pallidum [TaxId: 160]}
pkyegnidiglkgkvltiggadaetlmdaavdvfadgqpklvsdqavslgqnvlsadftp
gteytvevrfkefgsvrakvv

SCOPe Domain Coordinates for d1o75b2:

Click to download the PDB-style file with coordinates for d1o75b2.
(The format of our PDB-style files is described here.)

Timeline for d1o75b2: