Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.20: Tp47 lipoprotein, middle and C-terminal domains [81986] (1 family) |
Family b.1.20.1: Tp47 lipoprotein, middle and C-terminal domains [81987] (1 protein) contains two different domains of immunoglobulin-like fold |
Protein Tp47 lipoprotein, middle and C-terminal domains [81988] (1 species) a penicillin-binding protein with carboxypeptidase activity |
Species Treponema pallidum [TaxId:160] [81989] (1 PDB entry) |
Domain d1o75b2: 1o75 B:333-413 [81121] Other proteins in same PDB: d1o75a3, d1o75b3 complexed with pdx, xe |
PDB Entry: 1o75 (more details), 1.95 Å
SCOPe Domain Sequences for d1o75b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o75b2 b.1.20.1 (B:333-413) Tp47 lipoprotein, middle and C-terminal domains {Treponema pallidum [TaxId: 160]} pkyegnidiglkgkvltiggadaetlmdaavdvfadgqpklvsdqavslgqnvlsadftp gteytvevrfkefgsvrakvv
Timeline for d1o75b2: