Lineage for d1o70a1 (1o70 A:328-467)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2409860Fold b.118: FAS1 domain [82152] (1 superfamily)
    core: barrel, closed; n=7, S=12; meander
  4. 2409861Superfamily b.118.1: FAS1 domain [82153] (1 family) (S)
    automatically mapped to Pfam PF02469
  5. 2409862Family b.118.1.1: FAS1 domain [82154] (2 protein domains)
  6. 2409863Protein Fasciclin I [82155] (1 species)
    duplication: tandem repeat of four FAS1 domain
  7. 2409864Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [82156] (1 PDB entry)
  8. 2409865Domain d1o70a1: 1o70 A:328-467 [81115]
    two C-terminal FAS1 domains
    complexed with so4

Details for d1o70a1

PDB Entry: 1o70 (more details), 2.6 Å

PDB Description: Novel Fold Revealed by the Structure of a FAS1 Domain Pair from the Insect Cell Adhesion Molecule Fasciclin I
PDB Compounds: (A:) fasciclin I

SCOPe Domain Sequences for d1o70a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o70a1 b.118.1.1 (A:328-467) Fasciclin I {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
aengalrkfyevimdnggavlddinsltevtilapsneawnssninnvlrdrnkmrqiln
mhiikdrlnvdkirqknanliaqvptvnnntflyfnvrgegsdtvitvegggvnatviqa
dvaqtngyvhiidhvlgvpy

SCOPe Domain Coordinates for d1o70a1:

Click to download the PDB-style file with coordinates for d1o70a1.
(The format of our PDB-style files is described here.)

Timeline for d1o70a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o70a2