SCOP 1.65: Domain d1o6zd2: 1o6z D:163-330

Lineage for d1o6zd2 (1o6z D:163-330)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)

6. Protein Malate dehydrogenase [56329] (11 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [56335] (5 PDB entries)

8. Domain d1o6zd2: 1o6z D:163-330 [81114]
   Other proteins in same PDB: d1o6za1, d1o6zb1, d1o6zc1, d1o6zd1
   complexed with cl, nad; mutant

Details for d1o6zd2

PDB Entry: 1o6z, 1.95 Å

PDB Description: 1.95 a resolution structure of (r207s,r292s) mutant of malate dehydrogenase from the halophilic archaeon haloarcula marismortui (holo form)

SCOP Domain Sequences for d1o6zd2:

Sequence; same for both SEQRES and ATOM records:

>d1o6zd2 d.162.1.1 (D:163-330) Malate dehydrogenase {Archaeon Haloarcula marismortui}
fggrldsarfryvlseefdapvqnvegtilgehgdaqvpvfskvsvdgtdpefsgdekeq
llgdlqesamdvierkgatewgpargvahmveailhdtgevlpasvklegefghedtafg
vpvslgsngveeivewdlddyeqdlmadaaeklsdqydkis

Timeline for d1o6zd2:

• d1o6zd2 first appeared in SCOP 1.63
  
• d1o6zd2 appears in SCOP 1.67
  
• d1o6zd2 appears in the current release, SCOPe 2.08