SCOPe 2.05: Domain d1o6zb1: 1o6z B:22-162

Lineage for d1o6zb1 (1o6z B:22-162)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Malate dehydrogenase [51849] (13 species)

7. Species Haloarcula marismortui [TaxId:2238] [51855] (5 PDB entries)

8. Domain d1o6zb1: 1o6z B:22-162 [81109]
   Other proteins in same PDB: d1o6za2, d1o6zb2, d1o6zc2, d1o6zd2
   complexed with cl, nad; mutant

Details for d1o6zb1

PDB Entry: 1o6z, 1.95 Å

PDB Description: 1.95 a resolution structure of (r207s,r292s) mutant of malate dehydrogenase from the halophilic archaeon haloarcula marismortui (holo form)

PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d1o6zb1:

Sequence, based on SEQRES records:

>d1o6zb1 c.2.1.5 (B:22-162) Malate dehydrogenase {Haloarcula marismortui [TaxId: 2238]}
tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
rqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyislttsn
pvdllnrhlyeagdrsreqvig

Sequence, based on observed residues (ATOM records):

>d1o6zb1 c.2.1.5 (B:22-162) Malate dehydrogenase {Haloarcula marismortui [TaxId: 2238]}
tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
rqggyedtagsdvvvitagiqtridlagdnapimediqssldehnddyislttsnpvdll
nrhlyeagdrsreqvig

Timeline for d1o6zb1:

• d1o6zb1 first appeared in SCOP 1.63
  
• d1o6zb1 appears in SCOPe 2.04
  
• d1o6zb1 appears in SCOPe 2.06
  
• d1o6zb1 appears in the current release, SCOPe 2.08