Lineage for d1o6vb2 (1o6v B:36-416)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2098542Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2098611Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2098612Family c.10.2.1: Internalin LRR domain [52059] (4 protein domains)
    capped at the N-end with a truncated EF-hand subdomain
  6. 2098613Protein Internalin A [82324] (1 species)
  7. 2098614Species Listeria monocytogenes [TaxId:1639] [82325] (10 PDB entries)
  8. 2098617Domain d1o6vb2: 1o6v B:36-416 [81102]
    Other proteins in same PDB: d1o6va1, d1o6va3, d1o6vb1
    complexed with ca

Details for d1o6vb2

PDB Entry: 1o6v (more details), 1.5 Å

PDB Description: Internalin (Listeria monocytogenes) - functional domain, uncomplexed
PDB Compounds: (B:) internalin a

SCOPe Domain Sequences for d1o6vb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o6vb2 c.10.2.1 (B:36-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}
atitqdtpinqiftdtalaekmktvlgktnvtdtvsqtdldqvttlqadrlgiksidgve
ylnnltqinfsnnqltditplknltklvdilmnnnqiaditplanltnltgltlfnnqit
didplknltnlnrlelssntisdisalsgltslqqlsfgnqvtdlkplanlttlerldis
snkvsdisvlakltnlesliatnnqisditplgiltnldelslngnqlkdigtlasltnl
tdldlannqisnlaplsgltkltelklganqisnisplagltaltnlelnenqledispi
snlknltyltlyfnnisdispvssltklqrlffynnkvsdvsslanltninwlsaghnqi
sdltplanltritqlglndqa

SCOPe Domain Coordinates for d1o6vb2:

Click to download the PDB-style file with coordinates for d1o6vb2.
(The format of our PDB-style files is described here.)

Timeline for d1o6vb2: