SCOP 1.73: Domain d1o6vb1: 1o6v B:417-496

Lineage for d1o6vb1 (1o6v B:417-496)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (20 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.15: Internalin Ig-like domain [81295] (3 proteins)
   truncated fold fused to an LRR domain

6. Protein Internalin A [81973] (1 species)

7. Species Listeria monocytogenes [TaxId:1639] [81974] (6 PDB entries)

8. Domain d1o6vb1: 1o6v B:417-496 [81101]
   Other proteins in same PDB: d1o6va2, d1o6vb2
   complexed with ca

Details for d1o6vb1

PDB Entry: 1o6v, 1.5 Å

PDB Description: internalin (inla, listeria monocytogenes) - functional domain, uncomplexed

PDB Compounds: (B:) internalin a

SCOP Domain Sequences for d1o6vb1:

Sequence; same for both SEQRES and ATOM records:

>d1o6vb1 b.1.18.15 (B:417-496) Internalin A {Listeria monocytogenes [TaxId: 1639]}
wtnapvnykanvsipntvknvtgaliapatisdggsytepditwnlpsytnevsytfsqp
vtigkgtttfsgtvtqplka

Timeline for d1o6vb1:

• d1o6vb1 first appeared in SCOP 1.63
  
• d1o6vb1 appears in SCOP 1.71
  
• d1o6vb1 appears in SCOP 1.75
  
• d1o6vb1 appears in the current release, SCOPe 2.08