SCOPe 2.06: Domain d1o6ta1: 1o6t A:417-496

Lineage for d1o6ta1 (1o6t A:417-496)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.15: Internalin Ig-like domain [81295] (3 proteins)
   truncated fold fused to an LRR domain

6. Protein Internalin A [81973] (1 species)

7. Species Listeria monocytogenes [TaxId:1639] [81974] (10 PDB entries)

8. Domain d1o6ta1: 1o6t A:417-496 [81097]
   Other proteins in same PDB: d1o6ta2, d1o6ta3
   complexed with ca, cl, mes, mg, so4

Details for d1o6ta1

PDB Entry: 1o6t, 1.6 Å

PDB Description: internalin (inla, listeria monocytogenes) - functional domain, uncomplexed

PDB Compounds: (A:) internalin a

SCOPe Domain Sequences for d1o6ta1:

Sequence; same for both SEQRES and ATOM records:

>d1o6ta1 b.1.18.15 (A:417-496) Internalin A {Listeria monocytogenes [TaxId: 1639]}
wtnapvnykanvsipntvknvtgaliapatisdggsytepditwnlpsytnevsytfsqp
vtigkgtttfsgtvtqplka

Timeline for d1o6ta1:

• d1o6ta1 first appeared in SCOP 1.63
  
• d1o6ta1 appears in SCOPe 2.05
  
• d1o6ta1 appears in SCOPe 2.07
  
• d1o6ta1 appears in the current release, SCOPe 2.08