Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.6: Cadherin [49313] (1 family) |
Family b.1.6.1: Cadherin [49314] (3 proteins) |
Protein E-cadherin (epithelial) [49317] (2 species) synonym: uvomorulin |
Species Human (Homo sapiens) [TaxId:9606] [81981] (1 PDB entry) |
Domain d1o6sb_: 1o6s B: [81096] Other proteins in same PDB: d1o6sa1, d1o6sa2 domain 1 complexed with ca, cl |
PDB Entry: 1o6s (more details), 1.8 Å
SCOP Domain Sequences for d1o6sb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o6sb_ b.1.6.1 (B:) E-cadherin (epithelial) {Human (Homo sapiens)} gplgswvippiscpenekgpfpknlvqiksnkdkegkvfysitgqgadtppvgvfiiere tgwlkvtepldreriatytlfshavssngnavedpmeilitvtdq
Timeline for d1o6sb_: