| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.6: Cadherin-like [49313] (4 families) ![]() |
| Family b.1.6.1: Cadherin [49314] (4 proteins) |
| Protein E-cadherin (epithelial) [49317] (2 species) synonym: uvomorulin |
| Species Human (Homo sapiens) [TaxId:9606] [81981] (12 PDB entries) |
| Domain d1o6sb1: 1o6s B:2-101 [81096] Other proteins in same PDB: d1o6sa1, d1o6sa2, d1o6sb2 domain 1 complexed with ca, cl |
PDB Entry: 1o6s (more details), 1.8 Å
SCOPe Domain Sequences for d1o6sb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o6sb1 b.1.6.1 (B:2-101) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]}
wvippiscpenekgpfpknlvqiksnkdkegkvfysitgqgadtppvgvfiieretgwlk
vtepldreriatytlfshavssngnavedpmeilitvtdq
Timeline for d1o6sb1: