Lineage for d1o6sb1 (1o6s B:2-101)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763414Superfamily b.1.6: Cadherin-like [49313] (4 families) (S)
  5. 2763415Family b.1.6.1: Cadherin [49314] (4 proteins)
  6. 2763423Protein E-cadherin (epithelial) [49317] (2 species)
    synonym: uvomorulin
  7. 2763424Species Human (Homo sapiens) [TaxId:9606] [81981] (12 PDB entries)
  8. 2763432Domain d1o6sb1: 1o6s B:2-101 [81096]
    Other proteins in same PDB: d1o6sa1, d1o6sa2, d1o6sb2
    domain 1
    complexed with ca, cl

Details for d1o6sb1

PDB Entry: 1o6s (more details), 1.8 Å

PDB Description: internalin (listeria monocytogenes) / e-cadherin (human) recognition complex
PDB Compounds: (B:) e-cadherin

SCOPe Domain Sequences for d1o6sb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o6sb1 b.1.6.1 (B:2-101) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]}
wvippiscpenekgpfpknlvqiksnkdkegkvfysitgqgadtppvgvfiieretgwlk
vtepldreriatytlfshavssngnavedpmeilitvtdq

SCOPe Domain Coordinates for d1o6sb1:

Click to download the PDB-style file with coordinates for d1o6sb1.
(The format of our PDB-style files is described here.)

Timeline for d1o6sb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o6sb2