Lineage for d1o6sa2 (1o6s A:36-416)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 240418Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (2 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N
  4. 240457Superfamily c.10.2: L domain-like [52058] (7 families) (S)
    less regular structure consisting of variable repeats
  5. 240458Family c.10.2.1: Internalin LRR domain [52059] (3 proteins)
    capped at the N-end with a truncated EF-hand subdomain
  6. 240459Protein Internalin A [82324] (1 species)
  7. 240460Species Listeria monocytogenes [TaxId:1639] [82325] (3 PDB entries)
  8. 240464Domain d1o6sa2: 1o6s A:36-416 [81095]
    Other proteins in same PDB: d1o6sa1, d1o6sb_
    complexed with ca, cl

Details for d1o6sa2

PDB Entry: 1o6s (more details), 1.8 Å

PDB Description: internalin (listeria monocytogenes) / e-cadherin (human) recognition complex

SCOP Domain Sequences for d1o6sa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o6sa2 c.10.2.1 (A:36-416) Internalin A {Listeria monocytogenes}
atitqdtpinqiftdtalaekmktvlgktnvtdtvsqtdldqvttlqadrlgiksidgve
ylnnltqinfsnnqltditplknltklvdilmnnnqiaditplanltnltgltlfnnqit
didplknltnlnrlelssntisdisalsgltslqqlsfgnqvtdlkplanlttlerldis
snkvsdisvlakltnlesliatnnqisditplgiltnldelslngnqlkdigtlasltnl
tdldlannqisnlaplsgltkltelklganqisnisplagltaltnlelnenqledispi
snlknltyltlyfnnisdispvssltklqrlffynnkvsdvsslanltninwlsaghnqi
sdltplanltritqlglndqa

SCOP Domain Coordinates for d1o6sa2:

Click to download the PDB-style file with coordinates for d1o6sa2.
(The format of our PDB-style files is described here.)

Timeline for d1o6sa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o6sa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1o6sb_