SCOPe 2.06: Domain d1o6jb_: 1o6j B:

Lineage for d1o6jb_ (1o6j B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein Tryparedoxin II [64062] (1 species)

7. Species Crithidia fasciculata [TaxId:5656] [64063] (6 PDB entries)

8. Domain d1o6jb_: 1o6j B: [81090]

Details for d1o6jb_

PDB Entry: 1o6j, 2.35 Å

PDB Description: tryparedoxin ii from c.fasciculata solved by sulphur phasing

PDB Compounds: (B:) tryparedoxin II

SCOPe Domain Sequences for d1o6jb_:

Sequence; same for both SEQRES and ATOM records:

>d1o6jb_ c.47.1.10 (B:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]}
msglkkffpystnvlkgaaadialpslagktvffyfsaswcppcraftpqlidfykahae
kknfevmliswdesaedfkdyyakmpwlalpfedrkgmeflttgfdvksiptlvgveads
gniittqartmvvkdpeakdfpwpnve

Timeline for d1o6jb_:

• d1o6jb_ first appeared in SCOP 1.63
  
• d1o6jb_ appears in SCOPe 2.05
  
• d1o6jb_ appears in SCOPe 2.07
  
• d1o6jb_ appears in the current release, SCOPe 2.08