Lineage for d1o6jb_ (1o6j B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1853530Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 1853835Protein Tryparedoxin II [64062] (1 species)
  7. 1853836Species Crithidia fasciculata [TaxId:5656] [64063] (6 PDB entries)
  8. 1853847Domain d1o6jb_: 1o6j B: [81090]

Details for d1o6jb_

PDB Entry: 1o6j (more details), 2.35 Å

PDB Description: tryparedoxin ii from c.fasciculata solved by sulphur phasing
PDB Compounds: (B:) tryparedoxin II

SCOPe Domain Sequences for d1o6jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o6jb_ c.47.1.10 (B:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]}
msglkkffpystnvlkgaaadialpslagktvffyfsaswcppcraftpqlidfykahae
kknfevmliswdesaedfkdyyakmpwlalpfedrkgmeflttgfdvksiptlvgveads
gniittqartmvvkdpeakdfpwpnve

SCOPe Domain Coordinates for d1o6jb_:

Click to download the PDB-style file with coordinates for d1o6jb_.
(The format of our PDB-style files is described here.)

Timeline for d1o6jb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1o6ja_