Lineage for d1o6ja_ (1o6j A:)
- Root: SCOP 1.63
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the restSuperfamily c.47.1: Thioredoxin-like [52833] (12 families) 
Family c.47.1.10: Glutathione peroxidase-like [52901] (11 proteins) 
Protein Tryparedoxin II [64062] (1 species) Species Crithidia fasciculata [TaxId:5656] [64063] (4 PDB entries) 
Domain d1o6ja_: 1o6j A: [81089]
Details for d1o6ja_
PDB Entry: 1o6j (more details), 2.35 Å
PDB Description: tryparedoxin ii from c.fasciculata solved by sulphur phasing
SCOP Domain Sequences for d1o6ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o6ja_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata}
msglkkffpystnvlkgaaadialpslagktvffyfsaswcppcraftpqlidfykahae
kknfevmliswdesaedfkdyyakmpwlalpfedrkgmeflttgfdvksiptlvgveads
gniittqartmvvkdpeakdfpwpnveakk
SCOP Domain Coordinates for d1o6ja_:
Click to download the PDB-style file with coordinates for d1o6ja_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1o6ja_:
- d1o6ja_ is new in SCOP 1.63
- d1o6ja_ appears in SCOP 1.65
- d1o6ja_ appears in the current release, SCOPe 2.08
View in 3D
