SCOPe 2.06: Domain d1o6fa1: 1o6f A:1-430

Lineage for d1o6fa1 (1o6f A:1-430)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.7: Peptidase/esterase 'gauge' domain [50993] (3 families)

5. Family b.69.7.1: Prolyl oligopeptidase, N-terminal domain [50994] (2 proteins)
   automatically mapped to Pfam PF02897

6. Protein Prolyl oligopeptidase, N-terminal domain [50995] (1 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50996] (27 PDB entries)
   Uniprot P23687

8. Domain d1o6fa1: 1o6f A:1-430 [81085]
   Other proteins in same PDB: d1o6fa2
   complexed with gly, gol, pro, sin; mutant

Details for d1o6fa1

PDB Entry: 1o6f, 1.6 Å

PDB Description: prolyl oligopeptidase from porcine brain, d641a mutant with bound peptide ligand suc-gly-pro

PDB Compounds: (A:) prolyl endopeptidase

SCOPe Domain Sequences for d1o6fa1:

Sequence; same for both SEQRES and ATOM records:

>d1o6fa1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
mlsfqypdvyrdetaiqdyhghkvcdpyawledpdseqtkafveaqnkitvpfleqcpir
glykermtelydypkyschfkkgkryfyfyntglqnqrvlyvqdslegearvfldpnils
ddgtvalrgyafsedgeyfayglsasgsdwvtikfmkvdgakelpdvlervkfscmawth
dgkgmfynaypqqdgksdgtetstnlhqklyyhvlgtdqsedilcaefpdepkwmggael
sddgryvllsiregcdpvnrlwycdlqqesngitgilkwvklidnfegeydyvtnegtvf
tfktnrhspnyrlinidftdpeeskwkvlvpehekdvlewvacvrsnflvlcylhdvknt
lqlhdlatgallkifplevgsvvgysgqkkdteifyqftsflspgiiyhcdltkeelepr
vfrevtvkgi

Timeline for d1o6fa1:

• d1o6fa1 first appeared in SCOP 1.63
  
• d1o6fa1 appears in SCOPe 2.05
  
• d1o6fa1 appears in SCOPe 2.07
  
• d1o6fa1 appears in the current release, SCOPe 2.08