Lineage for d1o6ea_ (1o6e A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2395155Fold b.57: Herpes virus serine proteinase, assemblin [50788] (1 superfamily)
    core: barrel, closed; n=7, S=8; complex topology
  4. 2395156Superfamily b.57.1: Herpes virus serine proteinase, assemblin [50789] (2 families) (S)
    automatically mapped to Pfam PF00716
  5. 2395157Family b.57.1.1: Herpes virus serine proteinase, assemblin [50790] (5 protein domains)
  6. 2395158Protein Epstein-Barr virus protease [82149] (1 species)
  7. 2395159Species Human herpesvirus 4 [TaxId:10376] [82150] (1 PDB entry)
  8. 2395160Domain d1o6ea_: 1o6e A: [81083]
    complexed with isp

Details for d1o6ea_

PDB Entry: 1o6e (more details), 2.3 Å

PDB Description: epstein-barr virus protease
PDB Compounds: (A:) Capsid protein P40

SCOPe Domain Sequences for d1o6ea_:

Sequence, based on SEQRES records: (download)

>d1o6ea_ b.57.1.1 (A:) Epstein-Barr virus protease {Human herpesvirus 4 [TaxId: 10376]}
apsvyvcgfverpdappkdaclhldpltvksqlplkkplpltvehlpdapvgsvfglyqs
saglfsaasitsgdflslldsiyhdcdiaqsqrlplprepkvealhawlpslslaslhpd
ipqttadggklsffdhvsicalgrrrgttavygtdlawvlkhfsdlepsiaaqiendana
akresgcpedhplpltkliakaidagflrnrvetlrqdrgvanipaesylka

Sequence, based on observed residues (ATOM records): (download)

>d1o6ea_ b.57.1.1 (A:) Epstein-Barr virus protease {Human herpesvirus 4 [TaxId: 10376]}
apsvyvcgfverpdappkdaclhldpltvksqlplkkplpltvehlpdapvgsvfglyqs
saglfsaasitsgdflslldsiyhdcdiaqsqrlplprepkvealhawlpslslaslhpd
ipqttadggklsffdhvsicalgrrrgttavygtdlawvlkhfsdlepsiaaqiendana
akrhplpltkliakaidagflrnrvetlrqdrgvanipaesylka

SCOPe Domain Coordinates for d1o6ea_:

Click to download the PDB-style file with coordinates for d1o6ea_.
(The format of our PDB-style files is described here.)

Timeline for d1o6ea_: