SCOPe 2.04: Domain d1o23c_: 1o23 C:

Lineage for d1o23c_ (1o23 C:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
   automatically mapped to Pfam PF00062

6. Protein alpha-Lactalbumin [53975] (6 species)
   expressed only in the lactating mammary gland, strongly binds calcium ion

7. Species Mouse (Mus musculus) [TaxId:10090] [69628] (12 PDB entries)

8. Domain d1o23c_: 1o23 C: [81081]
   Other proteins in same PDB: d1o23b_, d1o23d_
   complexed with ca, mes, mn, pg4, udp, upg

Details for d1o23c_

PDB Entry: 1o23, 2.32 Å

PDB Description: crystal structure of lactose synthase in the presence of udp-glucose

PDB Compounds: (C:) alpha-lactalbumin

SCOPe Domain Sequences for d1o23c_:

Sequence; same for both SEQRES and ATOM records:

>d1o23c_ d.2.1.2 (C:) alpha-Lactalbumin {Mouse (Mus musculus) [TaxId: 10090]}
teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw
ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc
ekp

Timeline for d1o23c_:

• d1o23c_ first appeared in SCOP 1.63
  
• d1o23c_ appears in SCOPe 2.03
  
• d1o23c_ appears in SCOPe 2.05
  
• d1o23c_ appears in the current release, SCOPe 2.08