Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.2: C-type lysozyme [53960] (3 proteins) automatically mapped to Pfam PF00062 |
Protein alpha-Lactalbumin [53975] (6 species) expressed only in the lactating mammary gland, strongly binds calcium ion |
Species Mouse (Mus musculus) [TaxId:10090] [69628] (12 PDB entries) |
Domain d1o23c_: 1o23 C: [81081] Other proteins in same PDB: d1o23b_, d1o23d_ complexed with ca, mes, mn, pg4, udp, upg |
PDB Entry: 1o23 (more details), 2.32 Å
SCOPe Domain Sequences for d1o23c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o23c_ d.2.1.2 (C:) alpha-Lactalbumin {Mouse (Mus musculus) [TaxId: 10090]} teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc ekp
Timeline for d1o23c_: