Lineage for d1o23b_ (1o23 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1868080Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 1868081Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 1868090Family c.68.1.2: beta 1,4 galactosyltransferase (b4GalT1) [53452] (2 proteins)
  6. 1868091Protein beta 1,4 galactosyltransferase (b4GalT1) [53453] (1 species)
  7. 1868092Species Cow (Bos taurus) [TaxId:9913] [53454] (20 PDB entries)
    Uniprot P08037 131-402
  8. 1868116Domain d1o23b_: 1o23 B: [81080]
    Other proteins in same PDB: d1o23a_, d1o23c_
    complexed with ca, mes, mn, pg4, udp, upg

Details for d1o23b_

PDB Entry: 1o23 (more details), 2.32 Å

PDB Description: crystal structure of lactose synthase in the presence of udp-glucose
PDB Compounds: (B:) beta-1,4-galactosyltransferase

SCOPe Domain Sequences for d1o23b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o23b_ c.68.1.2 (B:) beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos taurus) [TaxId: 9913]}
ltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrn
rqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvf
sdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnn
ywgwggedddiynrlafrgmsvsrpnavigkcrmirhsrdkknepnpqrfdriahtketm
lsdglnsltymvlevqryplytkitvdigtps

SCOPe Domain Coordinates for d1o23b_:

Click to download the PDB-style file with coordinates for d1o23b_.
(The format of our PDB-style files is described here.)

Timeline for d1o23b_: