Lineage for d1o1pa1 (1o1p A:1-142)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 530468Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 530506Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 530658Protein Hemoglobin, alpha-chain [46486] (19 species)
  7. 530720Species Human (Homo sapiens) [TaxId:9606] [46487] (162 PDB entries)
  8. 530793Domain d1o1pa1: 1o1p A:1-142 [81072]
    Other proteins in same PDB: d1o1pb_, d1o1pd_

Details for d1o1pa1

PDB Entry: 1o1p (more details), 1.8 Å

PDB Description: deoxy hemoglobin (a-gly-c:v1m; b,d:v1m,c93a,n108k)

SCOP Domain Sequences for d1o1pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o1pa1 a.1.1.2 (A:1-142) Hemoglobin, alpha-chain {Human (Homo sapiens)}
mlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk
kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
vhasldkflasvstvltskyrg

SCOP Domain Coordinates for d1o1pa1:

Click to download the PDB-style file with coordinates for d1o1pa1.
(The format of our PDB-style files is described here.)

Timeline for d1o1pa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o1pa2