Lineage for d1o1ob_ (1o1o B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1716690Protein Hemoglobin, beta-chain [46500] (24 species)
  7. 1716811Species Human (Homo sapiens) [TaxId:9606] [46501] (225 PDB entries)
    Uniprot P68871
  8. 1716889Domain d1o1ob_: 1o1o B: [81069]
    Other proteins in same PDB: d1o1oa_, d1o1oc_
    complexed with hem

Details for d1o1ob_

PDB Entry: 1o1o (more details), 1.8 Å

PDB Description: deoxy hemoglobin (a,c:v1m,v62l; b,d:v1m,v67l)
PDB Compounds: (B:) hemoglobin beta chain

SCOPe Domain Sequences for d1o1ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o1ob_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkllgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

SCOPe Domain Coordinates for d1o1ob_:

Click to download the PDB-style file with coordinates for d1o1ob_.
(The format of our PDB-style files is described here.)

Timeline for d1o1ob_: