Lineage for d1o1nd_ (1o1n D:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 275721Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 275722Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 275747Family a.1.1.2: Globins [46463] (18 proteins)
    Heme-binding protein
  6. 276117Protein Hemoglobin, beta-chain [46500] (18 species)
  7. 276166Species Human (Homo sapiens) [TaxId:9606] [46501] (100 PDB entries)
  8. 276231Domain d1o1nd_: 1o1n D: [81067]
    Other proteins in same PDB: d1o1na1, d1o1na2
    complexed with hem

Details for d1o1nd_

PDB Entry: 1o1n (more details), 1.8 Å

PDB Description: deoxy hemoglobin (a-glyglygly-c:v1m,l29w; b,d:v1m)
PDB Compounds: (D:)

SCOP Domain Sequences for d1o1nd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o1nd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Human (Homo sapiens)}
mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

SCOP Domain Coordinates for d1o1nd_:

Click to download the PDB-style file with coordinates for d1o1nd_.
(The format of our PDB-style files is described here.)

Timeline for d1o1nd_: