![]() | Class a: All alpha proteins [46456] (202 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (4 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (20 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, alpha-chain [46486] (17 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [46487] (114 PDB entries) |
![]() | Domain d1o1ma2: 1o1m A:145-285 [81061] Other proteins in same PDB: d1o1mb_, d1o1md_ genetically crosslinked hemoglobin complexed with hem; mutant |
PDB Entry: 1o1m (more details), 1.85 Å
SCOP Domain Sequences for d1o1ma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o1ma2 a.1.1.2 (A:145-285) Hemoglobin, alpha-chain {Human (Homo sapiens)} vlspadktnvkaawgkvgahageygaeafermflsfpttktyfphfdlshgsaqvkgqgk kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa vhasldkflasvstvltskyr
Timeline for d1o1ma2: