Lineage for d1o1ja2 (1o1j A:143-283)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976488Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 1976759Protein Hemoglobin, alpha-chain [46486] (24 species)
  7. 1976884Species Human (Homo sapiens) [TaxId:9606] [46487] (253 PDB entries)
    Uniprot P69905 P01922 P01934 P01935
  8. 1976989Domain d1o1ja2: 1o1j A:143-283 [81049]
    Other proteins in same PDB: d1o1jb_, d1o1jd_
    genetically crosslinked hemoglobin
    complexed with hem

Details for d1o1ja2

PDB Entry: 1o1j (more details), 1.9 Å

PDB Description: deoxy hemoglobin (a-gly-c:v1m,l29f,h58q; b,d:v1m,l106w)
PDB Compounds: (A:) hemoglobin alpha chain

SCOPe Domain Sequences for d1o1ja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o1ja2 a.1.1.2 (A:143-283) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]}
vlspadktnvkaawgkvgahageygaeafermflsfpttktyfphfdlshgsaqvkgqgk
kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
vhasldkflasvstvltskyr

SCOPe Domain Coordinates for d1o1ja2:

Click to download the PDB-style file with coordinates for d1o1ja2.
(The format of our PDB-style files is described here.)

Timeline for d1o1ja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o1ja1