Lineage for d1o1ja1 (1o1j A:1-142)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 631651Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 631652Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 631691Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 631855Protein Hemoglobin, alpha-chain [46486] (19 species)
  7. 631932Species Human (Homo sapiens) [TaxId:9606] [46487] (178 PDB entries)
  8. 632009Domain d1o1ja1: 1o1j A:1-142 [81048]
    Other proteins in same PDB: d1o1jb_, d1o1jd_

Details for d1o1ja1

PDB Entry: 1o1j (more details), 1.9 Å

PDB Description: deoxy hemoglobin (a-gly-c:v1m,l29f,h58q; b,d:v1m,l106w)
PDB Compounds: (A:) hemoglobin alpha chain

SCOP Domain Sequences for d1o1ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o1ja1 a.1.1.2 (A:1-142) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]}
mlspadktnvkaawgkvgahageygaeafermflsfpttktyfphfdlshgsaqvkgqgk
kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
vhasldkflasvstvltskyrg

SCOP Domain Coordinates for d1o1ja1:

Click to download the PDB-style file with coordinates for d1o1ja1.
(The format of our PDB-style files is described here.)

Timeline for d1o1ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o1ja2